224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Serine/threonine-protein phosphatase 2A activator |
|---|
Gene and Protein Information
| Gene ID | 5524 |
|---|---|
| Uniprot Accession IDs | Q15257 A2A347 A9IZU4 B4DXM4 Q15258 Q53GZ3 Q5TZQ2 Q9BUK1 Q9NNZ7 Q9NNZ8 Q9NNZ9 |
| Ensembl ID | ENSP00000377036 |
| Symbol | PPP2R4 PP2A PR53 PPP2R4 |
| Family | Belongs to the PTPA-type PPIase family. |
| Sequence | MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107976795 | PTPA | protein phosphatase 2 phosphatase activator | 9598 | VGNC:4828 | OMA, EggNOG |
| Macaque | 716874 | PTPA | protein phosphatase 2 phosphatase activator | 9544 | OMA, EggNOG | |
| Mouse | 110854 | Ptpa | protein phosphatase 2 protein activator | 10090 | MGI:1346006 | Inparanoid, OMA, EggNOG |
| Rat | 362102 | Ptpa | protein phosphatase 2 phosphatase activator | 10116 | RGD:1308354 | OMA, EggNOG |
| Dog | 491303 | PTPA | protein phosphatase 2 phosphatase activator | 9615 | VGNC:45164 | OMA, EggNOG |
| Horse | 100070047 | PTPA | protein phosphatase 2 phosphatase activator | 9796 | VGNC:22007 | OMA, EggNOG |
| Cow | 514460 | PTPA | protein phosphatase 2 phosphatase activator | 9913 | VGNC:33526 | Inparanoid, OMA, EggNOG |
| Pig | 100157517 | PTPA | protein phosphatase 2 phosphatase activator | 9823 | OMA, EggNOG | |
| Platypus | 100077508 | PTPA | protein phosphatase 2 phosphatase activator | 9258 | OMA, EggNOG | |
| Anole lizard | 100566267 | ptpa | protein phosphatase 2 phosphatase activator | 28377 | OMA, EggNOG | |
| Xenopus | 100125159 | ptpa | protein phosphatase 2 phosphatase activator | 8364 | XB-GENE-970102 | OMA, EggNOG |
| Zebrafish | 445031 | ptpa | protein phosphatase 2 phosphatase activator | 7955 | ZDB-GENE-040801-11 | OMA, EggNOG |
| C. elegans | 175395 | Y71H2AM.20 | Serine/threonine-protein phosphatase 2A activator | 6239 | OMA, EggNOG | |
| Fruitfly | 33555 | Ptpa | Phosphotyrosyl phosphatase activator | 7227 | FBgn0016698 | Inparanoid, EggNOG |
| S.cerevisiae | 854653 | RRD1 | peptidylprolyl isomerase RRD1 | 4932 | S000001415 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / phosphatase activator / Serine/threonine-protein phosphatase 2A activator
protein / enzyme modulator / phosphatase activator / Serine/threonine-protein phosphatase 2A activator
DTO Classes
protein / Enzyme modulator / Phosphatase modulator / Phosphatase activator / Serine/threonine-protein phosphatase 2A activator
protein / Enzyme modulator / Phosphatase modulator / Phosphatase activator / Serine/threonine-protein phosphatase 2A activator
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.