🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RAB35

DescriptionRas-related protein Rab-35

Gene and Protein Information

Gene ID11021
Uniprot Accession IDs Q15286 B2R6E0 B4E390
Ensembl ID ENSP00000229340
Symbol RAB1C RAY RAY H-ray RAB1C
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp104001711RAB35RAB35, member RAS oncogene family9598VGNC:13354OMA, EggNOG
Mouse77407Rab35RAB35, member RAS oncogene family10090MGI:1924657Inparanoid, OMA, EggNOG
Rat288700Rab35RAB35, member RAS oncogene family10116RGD:1306362Inparanoid, OMA
Dog611477RAB35RAB35, member RAS oncogene family9615VGNC:45278Inparanoid, OMA, EggNOG
Horse100053915RAB35RAB35, member RAS oncogene family9796VGNC:22111Inparanoid, OMA, EggNOG
Cow614521RAB35RAB35, member RAS oncogene family9913VGNC:33644Inparanoid, OMA, EggNOG
OpossumRAB35RAB35, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9774]13616Inparanoid, OMA, EggNOG
Chicken416983RAB35RAB35, member RAS oncogene family9031CGNC:5524Inparanoid, OMA, EggNOG
Anole lizard100553866rab35RAB35, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus394615rab35RAB35, member RAS oncogene family8364XB-GENE-489018OMA, EggNOG
Zebrafish445154rab35bRAB35, member RAS oncogene family b7955ZDB-GENE-040801-62OMA, EggNOG
C. elegans176560rab-35RAB family6239Inparanoid, OMA
Fruitfly33014Rab35CG9575 gene product from transcript CG9575-RD7227FBgn0031090Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.