🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RAB27A

DescriptionRas-related protein Rab-27A

Gene and Protein Information

Gene ID5873
Uniprot Accession IDs P51159 O00195 Q6FI40 Q9UIR9 Q9Y5U3 Rab-27
Ensembl ID ENSP00000379601
Symbol RAB27 GS2 RAM RAB27 HsT18676
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453455RAB27ARAB27A, member RAS oncogene family9598VGNC:7762OMA, EggNOG
Macaque697741RAB27ARAB27A, member RAS oncogene family9544Inparanoid, OMA, EggNOG
Mouse11891Rab27aRAB27A, member RAS oncogene family10090MGI:1861441Inparanoid, OMA, EggNOG
Rat50645Rab27aRAB27A, member RAS oncogene family10116RGD:620918Inparanoid, OMA
Dog608699RAB27ARAB27A, member RAS oncogene family9615VGNC:45267Inparanoid, OMA, EggNOG
Horse100054867RAB27ARAB27A, member RAS oncogene family9796VGNC:22100Inparanoid, OMA, EggNOG
Cow618035RAB27ARAB27A, member RAS oncogene family9913OMA, EggNOG
Pig606749RAB27ARAB27A, member RAS oncogene family9823Inparanoid, OMA, EggNOG
Opossum100020373RAB27ARAB27A, member RAS oncogene family13616Inparanoid, EggNOG
PlatypusRAB27ARAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766]9258OMA, EggNOG
Chicken415410RAB27ARAB27A, member RAS oncogene family9031CGNC:3268Inparanoid, OMA, EggNOG
Xenopus493339rab27aRAB27A, member RAS oncogene family8364XB-GENE-490563Inparanoid, OMA, EggNOG
Zebrafish570907rab27aRAB27A, member RAS oncogene family7955ZDB-GENE-050913-46Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.