🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RBM8A

DescriptionRNA-binding protein 8A

Gene and Protein Information

Gene ID9939
Uniprot Accession IDs Q9Y5S9 B3KQI9 Q6FHD1 Q6IQ40 Q9GZX8 Q9NZI4
Ensembl ID ENSP00000463058
Symbol RBM8 TAR Y14 RBM8 ZNRP RBM8B ZRNP1 BOV-1A BOV-1B BOV-1C MDS014 DEL1q21.1 C1DELq21.1
FamilyBelongs to the RBM8A family.
Sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse60365Rbm8aRNA binding motif protein 8a10090MGI:1913129Inparanoid, OMA
Rat295284Rbm8aRNA binding motif protein 8A10116RGD:1310099Inparanoid, OMA
Dog475827RBM8ARNA binding motif protein 8A9615VGNC:45426Inparanoid, OMA
Horse100034052RBM8ARNA binding motif protein 8A9796VGNC:22252Inparanoid, OMA
Cow518045RBM8ARNA binding motif protein 8A9913VGNC:33808Inparanoid, OMA
Pig100156173RBM8ARNA binding motif protein 8A9823Inparanoid, OMA
Opossum100012987RBM8ARNA binding motif protein 8A13616Inparanoid, OMA
Zebrafish503767rbm8aRNA binding motif protein 8A7955ZDB-GENE-050306-51Inparanoid, OMA
C. elegans175572rnp-4RNA-binding protein 8A6239Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.