224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Ras-related protein Rab-1B |
|---|
Gene and Protein Information
| Gene ID | 81876 |
|---|---|
| Uniprot Accession IDs | Q9H0U4 A8K7S1 |
| Ensembl ID | ENSP00000310226 |
| Family | Belongs to the small GTPase superfamily. Rab family. |
| Sequence | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 76308 | Rab1b | RAB1B, member RAS oncogene family | 10090 | MGI:1923558 | Inparanoid, OMA |
| Dog | 610762 | RAB1B | RAB1B, member RAS oncogene family | 9615 | VGNC:52037 | Inparanoid, OMA |
| Horse | 100058091 | RAB1B | RAB1B, member RAS oncogene family | 9796 | Inparanoid, OMA | |
| Cow | 540685 | RAB1B | RAB1B, member RAS oncogene family | 9913 | Inparanoid, OMA | |
| Opossum | 100015981 | RAB1B | RAB1B, member RAS oncogene family | 13616 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.