CENPA

DescriptionHistone H3-like centromeric protein A

Gene and Protein Information

Gene ID1058
Uniprot Accession IDs P49450 D6W544 Q53T74 Q9BVW2
Ensembl ID ENSP00000336868
Symbol CenH3 CENP-A
FamilyBelongs to the histone H3 family.
Sequence
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459086CENPAcentromere protein A9598VGNC:191OMA, EggNOG
Macaque697312CENPAcentromere protein A9544Inparanoid, OMA
Mouse12615Cenpacentromere protein A10090MGI:88375Inparanoid, OMA, EggNOG
Rat298850Cenpacentromere protein A10116RGD:1563607Inparanoid, OMA, EggNOG
Dog475692CENPAcentromere protein A9615VGNC:39101Inparanoid, OMA, EggNOG
Horse100055617CENPAcentromere protein A9796VGNC:16392Inparanoid, OMA, EggNOG
Cow782601LOC782601histone H3-like centromeric protein A9913OMA, EggNOG
Opossum100030899CENPAcentromere protein A13616Inparanoid, EggNOG
Anole lizard100552579LOC100552579histone H3-like centromeric protein A28377OMA, EggNOG
Xenopus549339cenpacentromere protein A8364XB-GENE-484234Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.