🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

REEP2

DescriptionReceptor expression-enhancing protein 2

Gene and Protein Information

Gene ID51308
Uniprot Accession IDs Q9BRK0 Q53EM8 Q9NYF2
Ensembl ID ENSP00000367590
Symbol C5orf19 SGC32445 SPG72 Yip2d C5orf19 SGC32445
FamilyBelongs to the DP1 family.
Sequence
MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462096REEP2receptor accessory protein 29598VGNC:4145OMA, EggNOG
Macaque716686REEP2receptor accessory protein 29544OMA, EggNOG
Mouse225362Reep2receptor accessory protein 210090MGI:2385070Inparanoid, OMA, EggNOG
Dog100683708REEP2receptor accessory protein 29615VGNC:45461Inparanoid, OMA, EggNOG
Horse100062247REEP2receptor accessory protein 29796VGNC:22288Inparanoid, OMA, EggNOG
Cow532432REEP2receptor accessory protein 29913VGNC:33852Inparanoid, OMA, EggNOG
Pig100520367REEP2receptor accessory protein 29823OMA, EggNOG
OpossumREEP2receptor accessory protein 2 [Source:HGNC Symbol;Acc:HGNC:17975]13616Inparanoid, EggNOG
Chicken771891REEP2receptor accessory protein 29031CGNC:13044Inparanoid, OMA, EggNOG
Anole lizard100558463reep2receptor accessory protein 228377Inparanoid, OMA, EggNOG
Xenopus100037847reep2receptor accessory protein 28364XB-GENE-961347Inparanoid, OMA, EggNOG
Zebrafish568927reep2receptor accessory protein 27955ZDB-GENE-050706-125Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.