224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cardiac phospholamban |
|---|
Gene and Protein Information
| Gene ID | 5350 |
|---|---|
| Uniprot Accession IDs | P26678 PLB |
| Ensembl ID | ENSP00000350132 |
| Symbol | PLB PLB CMD1P CMH18 |
| Family | Belongs to the phospholamban family. |
| Sequence | MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 18821 | Pln | phospholamban | 10090 | MGI:97622 | Inparanoid, OMA, EggNOG |
| Rat | 64672 | Pln | phospholamban | 10116 | RGD:619894 | Inparanoid, OMA, EggNOG |
| Dog | 414755 | PLN | phospholamban | 9615 | VGNC:44700 | Inparanoid, OMA, EggNOG |
| Horse | 100630668 | PLN | phospholamban | 9796 | VGNC:21584 | Inparanoid, OMA, EggNOG |
| Cow | 100125240 | PLN | phospholamban | 9913 | VGNC:33038 | Inparanoid, OMA, EggNOG |
| Opossum | 100617747 | PLN | phospholamban | 13616 | OMA, EggNOG | |
| Platypus | 100093363 | PLN | phospholamban | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 396378 | PLN | phospholamban | 9031 | CGNC:11054 | Inparanoid, OMA |
| Anole lizard | 100563710 | pln | phospholamban | 28377 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.