224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Proline-rich acidic protein 1 |
|---|
Gene and Protein Information
| Gene ID | 118471 |
|---|---|
| Uniprot Accession IDs | Q96NZ9 B7ZL57 B7ZL58 E9KL31 Q5VWY4 Q7Z4X5 Q8IWR3 Q8NCS2 |
| Ensembl ID | ENSP00000416126 |
| Symbol | UPA UPA PRO1195 |
| Sequence | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 22264 | Prap1 | proline-rich acidic protein 1 | 10090 | MGI:893573 | Inparanoid, EggNOG |
| Rat | 60574 | Prap1 | proline-rich acidic protein 1 | 10116 | RGD:61876 | Inparanoid, EggNOG |
| Dog | 608254 | PRAP1 | proline rich acidic protein 1 | 9615 | VGNC:53010 | Inparanoid, EggNOG |
| Cow | 512786 | PRAP1 | proline rich acidic protein 1 | 9913 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.