PSMB9

DescriptionProteasome subunit beta type-9

Gene and Protein Information

Gene ID5698
Uniprot Accession IDs P28065 B0V0T1 Q16523 Q5JNW4
Ensembl ID ENSP00000363993
Symbol LMP2 PSMB6i RING12 LMP2 PRAAS3 PSMB6i RING12 beta1i
FamilyBelongs to the peptidase T1B family.
Sequence
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque716980PSMB9proteasome subunit beta 99544Inparanoid, OMA
Mouse16912Psmb9proteasome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2)10090MGI:1346526Inparanoid, OMA
Rat24967Psmb9proteasome subunit beta 910116RGD:3427Inparanoid, OMA
Dog474867PSMB9proteasome subunit beta 99615VGNC:45100Inparanoid, OMA
Horse100060885PSMB9proteasome subunit beta 99796VGNC:21948Inparanoid, OMA
Cow510593PSMB9proteasome subunit beta 99913VGNC:33453Inparanoid, OMA
Opossum100026764PSMB9proteasome subunit beta 913616Inparanoid, OMA
Xenopus445259psmb9proteasome subunit beta 98364XB-GENE-481018Inparanoid, OMA
Zebrafish30665psmb9aproteasome subunit beta 9a7955ZDB-GENE-990415-140Inparanoid, OMA
C. elegans176978pbs-1Proteasome subunit beta type6239Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.