🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

UQCRH

DescriptionCytochrome b-c1 complex subunit 6, mitochondrial

Gene and Protein Information

Gene ID7388
Uniprot Accession IDs P07919 B2R4V9 D3DQ18 Q5TDF6 Q6LDB8 Q9BQ91
Ensembl ID ENSP00000309565
Symbol QCR6 UQCR8
FamilyBelongs to the UQCRH/QCR6 family.
Sequence
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp742376LOC742376cytochrome b-c1 complex subunit 6, mitochondrial9598OMA, EggNOG
Mouse66576Uqcrhubiquinol-cytochrome c reductase hinge protein10090MGI:1913826Inparanoid, OMA, EggNOG
Rat366448Uqcrhubiquinol-cytochrome c reductase hinge protein10116RGD:1305987Inparanoid, OMA, EggNOG
Dog608530UQCRHubiquinol-cytochrome c reductase hinge protein9615Inparanoid, OMA, EggNOG
Horse100051878LOC100051878cytochrome b-c1 complex subunit 6, mitochondrial9796OMA, EggNOG
Cow613899UQCRHubiquinol-cytochrome c reductase hinge protein9913Inparanoid, OMA, EggNOG
Pig100524873LOC100524873cytochrome b-c1 complex subunit 6, mitochondrial9823Inparanoid, OMA, EggNOG
Chicken771939UQCRHubiquinol-cytochrome c reductase hinge protein9031CGNC:13054Inparanoid, OMA, EggNOG
Anole lizard100560644LOC100560644cytochrome b-c1 complex subunit 6, mitochondrial28377OMA, EggNOG
Zebrafish566723uqcrhubiquinol-cytochrome c reductase hinge protein7955ZDB-GENE-051030-93Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    reductase    /    Cytochrome b-c1 complex subunit 6, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Reductase    /    Cytochrome b-c1 complex subunit 6, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.