🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PSMB2

DescriptionProteasome subunit beta type-2

Gene and Protein Information

Gene ID5690
Uniprot Accession IDs P49721 D3DPS0 P31145 Q9BWZ9
Ensembl ID ENSP00000362334
Symbol HC7-I
FamilyBelongs to the peptidase T1B family.
Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469277PSMB2proteasome subunit beta 29598VGNC:11806Inparanoid, OMA, EggNOG
Macaque712193PSMB2proteasome subunit beta 29544Inparanoid, OMA, EggNOG
Mouse26445Psmb2proteasome (prosome, macropain) subunit, beta type 210090MGI:1347045Inparanoid, OMA, EggNOG
Rat29675Psmb2proteasome subunit beta 210116RGD:61874Inparanoid, OMA, EggNOG
Dog475338PSMB2proteasome subunit beta 29615VGNC:45095Inparanoid, OMA, EggNOG
Horse100055325PSMB2proteasome subunit beta 29796VGNC:21941Inparanoid, OMA, EggNOG
Cow516919PSMB2proteasome subunit beta 29913VGNC:33446Inparanoid, OMA, EggNOG
Platypus100077529PSMB2proteasome subunit beta 29258Inparanoid, OMA, EggNOG
Chicken419630PSMB2proteasome subunit beta 29031CGNC:66347Inparanoid, OMA
Anole lizard100566839psmb2proteasome subunit beta 228377Inparanoid, OMA, EggNOG
Xenopus496467psmb2proteasome subunit beta 28364XB-GENE-946101Inparanoid, OMA, EggNOG
Zebrafish436882psmb2proteasome subunit beta 27955ZDB-GENE-040718-353Inparanoid, OMA, EggNOG
C. elegans171975pbs-4Proteasome subunit beta type-26239Inparanoid, OMA
S.cerevisiae856731PRE1proteasome core particle subunit beta 44932S000000814Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.