PAWR

DescriptionPRKC apoptosis WT1 regulator protein

Gene and Protein Information

Gene ID5074
Uniprot Accession IDs Q96IZ0 O75796 Q6FHY9 Q8N700
Ensembl ID ENSP00000328088
Symbol PAR4 PAR4 Par-4
Sequence
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452094PAWRpro-apoptotic WT1 regulator9598VGNC:8489OMA, EggNOG
Macaque695617PAWRpro-apoptotic WT1 regulator9544Inparanoid, OMA, EggNOG
Mouse114774PawrPRKC, apoptosis, WT1, regulator10090MGI:2149961Inparanoid, OMA, EggNOG
Rat64513Pawrpro-apoptotic WT1 regulator10116RGD:69065Inparanoid, OMA, EggNOG
OpossumPAWRpro-apoptotic WT1 regulator [Source:HGNC Symbol;Acc:HGNC:8614]13616Inparanoid, OMA, EggNOG
Chicken417870PAWRpro-apoptotic WT1 regulator9031CGNC:7853Inparanoid, OMA
Xenopus100486624pawrPRKC, apoptosis, WT1, regulator8364XB-GENE-987162Inparanoid, OMA, EggNOG
Zebrafish449994pawrPRKC, apoptosis, WT1, regulator7955ZDB-GENE-041010-108Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.