224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Pygopus homolog 2 |
|---|
Gene and Protein Information
| Gene ID | 90780 |
|---|---|
| Uniprot Accession IDs | Q9BRQ0 Q8WYZ4 Q96CY2 |
| Ensembl ID | ENSP00000357442 |
| Symbol | 1190004M21Rik |
| Sequence | MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469836 | PYGO2 | pygopus family PHD finger 2 | 9598 | VGNC:1480 | OMA, EggNOG |
| Macaque | 106992713 | PYGO2 | pygopus family PHD finger 2 | 9544 | OMA, EggNOG | |
| Mouse | 68911 | Pygo2 | pygopus 2 | 10090 | MGI:1916161 | Inparanoid, OMA, EggNOG |
| Rat | 295251 | Pygo2 | pygopus family PHD finger 2 | 10116 | RGD:1308535 | Inparanoid, OMA, EggNOG |
| Dog | 490440 | PYGO2 | pygopus family PHD finger 2 | 9615 | VGNC:45227 | Inparanoid, OMA, EggNOG |
| Horse | 100063020 | PYGO2 | pygopus family PHD finger 2 | 9796 | VGNC:22065 | Inparanoid, OMA, EggNOG |
| Cow | 540401 | PYGO2 | pygopus family PHD finger 2 | 9913 | VGNC:33591 | Inparanoid, OMA, EggNOG |
| Pig | 100151902 | PBXIP1 | PBX homeobox interacting protein 1 | 9823 | OMA, EggNOG | |
| Opossum | 100021360 | PYGO2 | pygopus family PHD finger 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | PYGO2 | pygopus family PHD finger 2 [Source:HGNC Symbol;Acc:HGNC:30257] | 28377 | Inparanoid, OMA, EggNOG | ||
| Zebrafish | 613247 | pygo2 | pygopus homolog 2 (Drosophila) | 7955 | ZDB-GENE-050809-108 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.