224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Proteasome subunit alpha type-1 |
|---|
Gene and Protein Information
| Gene ID | 5682 |
|---|---|
| Uniprot Accession IDs | P25786 A8K400 Q53YE8 Q9BRV9 |
| Ensembl ID | ENSP00000414359 |
| Symbol | HC2 NU PROS30 PSC2 NU HC2 PROS30 HEL-S-275 |
| Family | Belongs to the peptidase T1A family. |
| Sequence | MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451040 | PSMA1 | proteasome subunit alpha 1 | 9598 | VGNC:1037 | OMA, EggNOG |
| Macaque | 701029 | PSMA1 | proteasome subunit alpha 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26440 | Psma1 | proteasome (prosome, macropain) subunit, alpha type 1 | 10090 | MGI:1347005 | Inparanoid, OMA, EggNOG |
| Rat | 29668 | Psma1 | proteasome subunit alpha 1 | 10116 | RGD:61841 | Inparanoid, OMA, EggNOG |
| Horse | 100056224 | PSMA1 | proteasome subunit alpha 1 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 515503 | PSMA1 | proteasome subunit alpha 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100516779 | PSMA1 | proteasome subunit alpha 1 | 9823 | OMA, EggNOG | |
| Opossum | 100029192 | PSMA1 | proteasome subunit alpha 1 | 13616 | OMA, EggNOG | |
| Platypus | 100093532 | PSMA1 | proteasome subunit alpha 1 | 9258 | OMA, EggNOG | |
| Chicken | 395874 | PSMA1 | proteasome subunit alpha 1 | 9031 | CGNC:4513 | Inparanoid, OMA |
| Anole lizard | 100565392 | psma1 | proteasome subunit alpha 1 | 28377 | OMA, EggNOG | |
| Xenopus | psma1 | proteasome subunit alpha 1 [Source:Xenbase;Acc:XB-GENE-995831] | 8364 | OMA, EggNOG | ||
| Zebrafish | 445033 | psma1 | proteasome subunit alpha 1 | 7955 | ZDB-GENE-040801-15 | Inparanoid, OMA |
| C. elegans | 178943 | pas-6 | Proteasome subunit alpha type-1 | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 855362 | PRE5 | proteasome core particle subunit alpha 6 | 4932 | S000004931 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.