224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Dipeptidase 3 |
|---|
Gene and Protein Information
| Gene ID | 64180 |
|---|---|
| Uniprot Accession IDs | Q9H4B8 B3KQ48 Q6PEZ5 Q6UXE4 |
| Ensembl ID | ENSP00000268793 |
| Symbol | MBD3 |
| Family | Belongs to the metallo-dependent hydrolases superfamily. Peptidase M19 family. |
| Sequence | MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468006 | DPEP3 | dipeptidase 3 | 9598 | VGNC:5752 | OMA, EggNOG |
| Macaque | 701327 | DPEP3 | dipeptidase 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 71854 | Dpep3 | dipeptidase 3 | 10090 | MGI:1919104 | Inparanoid, OMA, EggNOG |
| Rat | 364994 | Dpep3 | dipeptidase 3 | 10116 | RGD:1305484 | Inparanoid, OMA, EggNOG |
| Horse | 100066409 | DPEP3 | dipeptidase 3 | 9796 | VGNC:17284 | Inparanoid, OMA |
| Chicken | 107054267 | DPEP2 | dipeptidase 2 | 9031 | CGNC:77247 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.