PSMA3

DescriptionProteasome subunit alpha type-3

Gene and Protein Information

Gene ID5684
Uniprot Accession IDs P25788 B2RCK6 Q86U83 Q8N1D8 Q9BS70
Ensembl ID ENSP00000216455
Symbol HC8 PSC8 HC8 PSC3
FamilyBelongs to the peptidase T1A family.
Sequence
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467469PSMA3proteasome subunit alpha 39598VGNC:3337OMA, EggNOG
Macaque700251PSMA3proteasome subunit alpha 39544Inparanoid, OMA, EggNOG
Mouse19167Psma3proteasome (prosome, macropain) subunit, alpha type 310090MGI:104883Inparanoid, OMA, EggNOG
Rat29670Psma3proteasome subunit alpha 310116RGD:61844Inparanoid, OMA, EggNOG
Dog480338PSMA3proteasome subunit alpha 39615VGNC:45090Inparanoid, OMA, EggNOG
Horse100050987PSMA3proteasome subunit alpha 39796VGNC:21933Inparanoid, OMA, EggNOG
Cow505176PSMA3proteasome subunit alpha 39913VGNC:33438Inparanoid, OMA, EggNOG
Pig100154408PSMA3proteasome subunit alpha 39823OMA, EggNOG
Opossum100021131PSMA3proteasome subunit alpha 313616Inparanoid, EggNOG
PlatypusPSMA3proteasome subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:9532]9258OMA, EggNOG
Chicken423542PSMA3proteasome subunit alpha 39031CGNC:9125Inparanoid, OMA, EggNOG
Anole lizard100556078psma3proteasome subunit alpha 328377Inparanoid, OMA, EggNOG
Xenopus496707psma3proteasome subunit alpha 38364XB-GENE-976787Inparanoid, OMA, EggNOG
Zebrafish564370psma3proteasome subunit alpha 37955ZDB-GENE-050913-120Inparanoid, OMA, EggNOG
C. elegans174571pas-7Proteasome subunit alpha type-36239Inparanoid, OMA, EggNOG
Fruitfly36018Prosalpha7Proteasome alpha7 subunit7227FBgn0023175Inparanoid, OMA, EggNOG
S.cerevisiae854544PRE10proteasome core particle subunit alpha 74932S000005889Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.