224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Profilin-1 |
|---|
Gene and Protein Information
| Gene ID | 5216 |
|---|---|
| Uniprot Accession IDs | P07737 Q53Y44 |
| Ensembl ID | ENSP00000225655 |
| Symbol | ALS18 |
| Family | Belongs to the profilin family. |
| Sequence | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748477 | PFN1 | profilin 1 | 9598 | VGNC:9511 | OMA, EggNOG |
| Macaque | 710753 | PFN1 | profilin 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18643 | Pfn1 | profilin 1 | 10090 | MGI:97549 | Inparanoid, OMA, EggNOG |
| Rat | 64303 | Pfn1 | profilin 1 | 10116 | RGD:621825 | Inparanoid, OMA, EggNOG |
| Dog | 607397 | PFN1 | profilin 1 | 9615 | VGNC:53432 | Inparanoid, OMA, EggNOG |
| Horse | 100061295 | PFN1 | profilin 1 | 9796 | OMA, EggNOG | |
| Cow | 513895 | PFN1 | profilin 1 | 9913 | OMA, EggNOG | |
| Pig | 100512494 | PFN1 | profilin 1 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100016522 | PFN1 | profilin 1 | 13616 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.