224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Serine/arginine-rich splicing factor 1 |
|---|
Gene and Protein Information
| Gene ID | 6426 |
|---|---|
| Uniprot Accession IDs | Q07955 B2R6Z7 D3DTZ3 Q13809 |
| Ensembl ID | ENSP00000258962 |
| Symbol | ASF SF2 SF2P33 SFRS1 ASF SF2 SFRS1 SF2p33 SRp30a |
| Family | Belongs to the splicing factor SR family. |
| Sequence | MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468417 | SRSF1 | serine and arginine rich splicing factor 1 | 9598 | VGNC:12697 | Inparanoid, OMA |
| Macaque | 713958 | SRSF1 | serine and arginine rich splicing factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 110809 | Srsf1 | serine/arginine-rich splicing factor 1 | 10090 | MGI:98283 | Inparanoid, OMA, EggNOG |
| Rat | 689890 | Srsf1 | serine and arginine rich splicing factor 1 | 10116 | RGD:1587490 | Inparanoid, OMA |
| Dog | 609693 | SRSF1 | serine and arginine rich splicing factor 1 | 9615 | VGNC:46816 | Inparanoid, OMA, EggNOG |
| Horse | 100056763 | SRSF1 | serine and arginine rich splicing factor 1 | 9796 | VGNC:23598 | Inparanoid, OMA, EggNOG |
| Cow | 615796 | SRSF1 | serine and arginine rich splicing factor 1 | 9913 | VGNC:35297 | Inparanoid, OMA, EggNOG |
| Pig | 654327 | SRSF1 | serine and arginine rich splicing factor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | SRSF1 | serine and arginine rich splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:10780] | 13616 | Inparanoid, OMA, EggNOG | ||
| Anole lizard | 100555961 | srsf1 | serine and arginine rich splicing factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448766 | srsf1 | serine/arginine-rich splicing factor 1 | 8364 | XB-GENE-486875 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393565 | srsf1b | serine/arginine-rich splicing factor 1b | 7955 | ZDB-GENE-040426-1467 | Inparanoid, OMA |
| C. elegans | 176688 | rsp-3 | Probable splicing factor, arginine/serine-rich 3 | 6239 | OMA, EggNOG | |
| Fruitfly | 53443 | SF2 | Splicing factor 2 | 7227 | FBgn0283477 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Serine/arginine-rich splicing factor 1
protein / nucleic acid binding / mRNA splicing factor / Serine/arginine-rich splicing factor 1
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Serine/arginine-rich splicing factor 1
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Serine/arginine-rich splicing factor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.