224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Serine/arginine-rich splicing factor 9 |
|---|
Gene and Protein Information
| Gene ID | 8683 |
|---|---|
| Uniprot Accession IDs | Q13242 Q52LD1 |
| Ensembl ID | ENSP00000229390 |
| Symbol | SFRS9 SRP30C SFRS9 SRp30c |
| Family | Belongs to the splicing factor SR family. |
| Sequence | MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742440 | SRSF9 | serine and arginine rich splicing factor 9 | 9598 | VGNC:14417 | OMA, EggNOG |
| Macaque | 697191 | SRSF9 | serine and arginine rich splicing factor 9 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 108014 | Srsf9 | serine/arginine-rich splicing factor 9 | 10090 | MGI:104896 | Inparanoid, OMA, EggNOG |
| Rat | 288701 | Srsf9 | serine and arginine rich splicing factor 9 | 10116 | RGD:1309495 | Inparanoid, OMA |
| Dog | 477510 | SRSF9 | serine and arginine rich splicing factor 9 | 9615 | VGNC:52970 | Inparanoid, OMA, EggNOG |
| Horse | SRSF9 | serine and arginine rich splicing factor 9 [Source:HGNC Symbol;Acc:HGNC:10791] | 9796 | OMA, EggNOG | ||
| Cow | 509905 | SRSF9 | serine and arginine rich splicing factor 9 | 9913 | VGNC:52832 | OMA, EggNOG |
| Pig | 100154637 | SRSF9 | serine and arginine rich splicing factor 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100617113 | SRSF9 | serine and arginine rich splicing factor 9 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100556727 | srsf9 | serine and arginine rich splicing factor 9 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448015 | srsf9 | serine/arginine-rich splicing factor 9 | 8364 | XB-GENE-491310 | Inparanoid, OMA, EggNOG |
| Zebrafish | 405835 | srsf9 | serine/arginine-rich splicing factor 9 | 7955 | ZDB-GENE-040426-2397 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Serine/arginine-rich splicing factor 9
protein / nucleic acid binding / mRNA splicing factor / Serine/arginine-rich splicing factor 9
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Serine/arginine-rich splicing factor 9
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Serine/arginine-rich splicing factor 9
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.