🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SNRPC

DescriptionU1 small nuclear ribonucleoprotein C

Gene and Protein Information

Gene ID6631
Uniprot Accession IDs P09234 Q5TAL3 U1 snRNP C
Ensembl ID ENSP00000244520
Symbol U1C Yhc1
FamilyBelongs to the U1 small nuclear ribonucleoprotein C family.
Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp747404SNRPCsmall nuclear ribonucleoprotein polypeptide C9598VGNC:11300OMA, EggNOG
Macaque718654SNRPCsmall nuclear ribonucleoprotein polypeptide C9544OMA, EggNOG
Mouse20630SnrpcU1 small nuclear ribonucleoprotein C10090MGI:109489Inparanoid, OMA, EggNOG
Rat361808Snrpcsmall nuclear ribonucleoprotein polypeptide C10116RGD:1306065Inparanoid, OMA, EggNOG
Horse100053207SNRPCsmall nuclear ribonucleoprotein polypeptide C9796VGNC:23397Inparanoid, OMA, EggNOG
Cow614553SNRPCsmall nuclear ribonucleoprotein polypeptide C9913VGNC:35078Inparanoid, OMA, EggNOG
Pig100154606SNRPCsmall nuclear ribonucleoprotein polypeptide C9823Inparanoid, OMA, EggNOG
Opossum100028059SNRPCsmall nuclear ribonucleoprotein polypeptide C13616OMA, EggNOG
PlatypusSNRPCsmall nuclear ribonucleoprotein polypeptide C [Source:HGNC Symbol;Acc:HGNC:11157]9258OMA, EggNOG
Chicken419901SNRPCsmall nuclear ribonucleoprotein polypeptide C9031CGNC:2000Inparanoid, OMA, EggNOG
Anole lizard100552525snrpcsmall nuclear ribonucleoprotein polypeptide C28377Inparanoid, OMA, EggNOG
Xenopus549352snrpcsmall nuclear ribonucleoprotein polypeptide C8364XB-GENE-495092Inparanoid, OMA, EggNOG
Zebrafish192330snrpcsmall nuclear ribonucleoprotein polypeptide C7955ZDB-GENE-020419-26Inparanoid, OMA
C. elegans177674F08B4.7U1 small nuclear ribonucleoprotein C6239Inparanoid, OMA
Fruitfly42274snRNP-U1-Csmall ribonucleoprotein particle U1 subunit C7227FBgn0261792Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.