SNRPA1

DescriptionU2 small nuclear ribonucleoprotein A'

Gene and Protein Information

Gene ID6627
Uniprot Accession IDs P09661 B2R5I6 Q8TBD2 U2 snRNP A'
Ensembl ID ENSP00000254193
Symbol Lea1 U2A'
FamilyBelongs to the U2 small nuclear ribonucleoprotein A family.
Sequence
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453692SNRPA1small nuclear ribonucleoprotein polypeptide A'9598OMA, EggNOG
Macaque694876SNRPA1small nuclear ribonucleoprotein polypeptide A'9544OMA, EggNOG
Mouse68981Snrpa1small nuclear ribonucleoprotein polypeptide A'10090MGI:1916231OMA, EggNOG
Rat100361269Snrpa1small nuclear ribonucleoprotein polypeptide A'10116RGD:2320494OMA, EggNOG
Dog607102SNRPA1small nuclear ribonucleoprotein polypeptide A'9615VGNC:46610OMA, EggNOG
Horse100050337SNRPA1small nuclear ribonucleoprotein polypeptide A'9796VGNC:23394OMA, EggNOG
Cow512584SNRPA1small nuclear ribonucleoprotein polypeptide A'9913VGNC:35075OMA, EggNOG
Pig100156573SNRPA1small nuclear ribonucleoprotein polypeptide A'9823OMA, EggNOG
Platypus100085772SNRPA1small nuclear ribonucleoprotein polypeptide A'9258OMA, EggNOG
Chicken415523SNRPA1small nuclear ribonucleoprotein polypeptide A'9031CGNC:50006OMA, EggNOG
Anole lizard100568276snrpa1small nuclear ribonucleoprotein polypeptide A'28377OMA, EggNOG
Zebrafish492511snrpa1small nuclear ribonucleoprotein polypeptide A'7955ZDB-GENE-041114-82OMA, EggNOG
C. elegans173767mog-2Probable U2 small nuclear ribonucleoprotein A'6239OMA, EggNOG
Fruitfly35713U2ACG1406 gene product from transcript CG1406-RA7227FBgn0033210OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    U2 small nuclear ribonucleoprotein A'
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    U2 small nuclear ribonucleoprotein A'

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.