224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Proton-coupled amino acid transporter 2 |
|---|
Gene and Protein Information
| Gene ID | 153201 |
|---|---|
| Uniprot Accession IDs | Q495M3 Q495M4 Q495M6 Q6ZWK5 Q7Z6B5 Proton/amino acid transporter 2 |
| Ensembl ID | ENSP00000334223 |
| Symbol | PAT2 TRAMD1 PAT2 TRAMD1 |
| Family | Belongs to the amino acid/polyamine transporter 2 family. |
| Sequence | MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPFMDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAVNSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTTFVR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462200 | SLC36A2 | solute carrier family 36 member 2 | 9598 | VGNC:13590 | OMA, EggNOG |
| Mouse | 246049 | Slc36a2 | solute carrier family 36 (proton/amino acid symporter), member 2 | 10090 | MGI:1891430 | Inparanoid, OMA, EggNOG |
| Rat | 246235 | Slc36a2 | solute carrier family 36 member 2 | 10116 | RGD:620492 | Inparanoid, OMA, EggNOG |
| Dog | 489174 | SLC36A2 | solute carrier family 36 member 2 | 9615 | VGNC:46383 | Inparanoid, OMA |
| Horse | 100071541 | SLC36A2 | solute carrier family 36 member 2 | 9796 | VGNC:23181 | Inparanoid, OMA |
| Cow | 509629 | SLC36A2 | solute carrier family 36 member 2 | 9913 | VGNC:34839 | Inparanoid, OMA |
| Zebrafish | 559308 | slc36a1 | solute carrier family 36 (proton/amino acid symporter), member 1 | 7955 | ZDB-GENE-061117-1 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transporter / amino acid transporter / Proton-coupled amino acid transporter 2
protein / transporter / amino acid transporter / Proton-coupled amino acid transporter 2
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC36 family of proton-coupled amino acid transporters / Proton-coupled amino acid transporter 2
protein / Transporter / SLC superfamily of solute carriers / SLC36 family of proton-coupled amino acid transporters / Proton-coupled amino acid transporter 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.