224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Death domain-containing protein CRADD |
|---|
Gene and Protein Information
| Gene ID | 8738 |
|---|---|
| Uniprot Accession IDs | P78560 B7Z2Q5 |
| Ensembl ID | ENSP00000439068 |
| Symbol | RAIDD MRT34 RAIDD |
| Sequence | MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452128 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 9598 | VGNC:8384 | OMA, EggNOG |
| Macaque | 711165 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12905 | Cradd | CASP2 and RIPK1 domain containing adaptor with death domain | 10090 | MGI:1336168 | Inparanoid, OMA, EggNOG |
| Dog | 482604 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 9615 | VGNC:39591 | Inparanoid, OMA, EggNOG |
| Cow | 615788 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 9913 | Inparanoid, EggNOG | |
| Opossum | 100011938 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100073885 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 417900 | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain | 9031 | CGNC:8588 | Inparanoid, OMA, EggNOG |
| Anole lizard | CRADD | CASP2 and RIPK1 domain containing adaptor with death domain [Source:HGNC Symbol;Acc:HGNC:2340] | 28377 | Inparanoid, EggNOG | ||
| Xenopus | 448758 | cradd.1 | CASP2 and RIPK1 domain containing adaptor with death, gene 1 | 8364 | XB-GENE-5852262 | Inparanoid, OMA, EggNOG |
| Zebrafish | 450046 | cradd | CASP2 and RIPK1 domain containing adaptor with death domain | 7955 | ZDB-GENE-041010-168 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.