🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

S100A2

DescriptionProtein S100-A2

Gene and Protein Information

Gene ID6273
Uniprot Accession IDs P29034 O00266 Q3KRB9 Q5RHS8 Q9BU83
Ensembl ID ENSP00000357697
Symbol S100L CAN19 S100L
FamilyBelongs to the S-100 family.
Sequence
MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457321S100A2S100 calcium binding protein A29598VGNC:53220OMA, EggNOG
Macaque715264S100A2S100 calcium binding protein A29544OMA, EggNOG
Dog612326S100A2S100 calcium binding protein A29615VGNC:45828Inparanoid, OMA, EggNOG
Horse100056230S100A2S100 calcium binding protein A29796VGNC:50881Inparanoid, OMA, EggNOG
Cow509860S100A2S100 calcium binding protein A29913VGNC:34242Inparanoid, OMA, EggNOG
Platypus100093329S100A2S100 calcium binding protein A29258Inparanoid, OMA, EggNOG
Zebrafish100005083icn2ictacalcin 27955ZDB-GENE-070822-9Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-A2
protein    /    calcium-binding protein    /    growth factor    /    Protein S100-A2
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-A2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.