224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | R-spondin-3 |
|---|
Gene and Protein Information
| Gene ID | 84870 |
|---|---|
| Uniprot Accession IDs | Q9BXY4 B2RC27 Q5VTV4 Q96K87 |
| Ensembl ID | ENSP00000349131 |
| Symbol | PWTSR THSD2 PWTSR THSD2 CRISTIN1 |
| Family | Belongs to the R-spondin family. |
| Sequence | MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745364 | RSPO3 | R-spondin 3 | 9598 | VGNC:11220 | OMA, EggNOG |
| Macaque | 712288 | RSPO3 | R-spondin 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 72780 | Rspo3 | R-spondin 3 | 10090 | MGI:1920030 | Inparanoid, OMA, EggNOG |
| Rat | 498997 | Rspo3 | R-spondin 3 | 10116 | RGD:1563246 | Inparanoid, OMA, EggNOG |
| Dog | 476287 | RSPO3 | R-spondin 3 | 9615 | VGNC:49764 | Inparanoid, OMA, EggNOG |
| Horse | 100067377 | RSPO3 | R-spondin 3 | 9796 | VGNC:22604 | Inparanoid, OMA, EggNOG |
| Pig | 100155208 | RSPO3 | R-spondin 3 | 9823 | OMA, EggNOG | |
| Opossum | 100024261 | RSPO3 | R-spondin 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | RSPO3 | R-spondin 3 [Source:HGNC Symbol;Acc:HGNC:20866] | 9258 | OMA, EggNOG | ||
| Xenopus | 496565 | rspo3 | R-spondin 3 | 8364 | XB-GENE-994474 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100007702 | rspo3 | R-spondin 3 | 7955 | ZDB-GENE-030131-9814 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.