SRPRB

DescriptionSignal recognition particle receptor subunit beta

Gene and Protein Information

Gene ID58477
Uniprot Accession IDs Q9Y5M8 Q6P595 Q8N2D8 SR-beta
Ensembl ID ENSP00000418401
Symbol APMCF1
FamilyBelongs to the SRP receptor beta subunit family.
Sequence
MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100610929SRPRBSRP receptor subunit beta9598VGNC:7126OMA, EggNOG
Macaque719024SRPRBSRP receptor beta subunit9544Inparanoid, OMA, EggNOG
Mouse20818Srprbsignal recognition particle receptor, B subunit10090MGI:102964Inparanoid, EggNOG
Cow100138613SRPRBSRP receptor subunit beta9913VGNC:35291OMA, EggNOG
Pig100523141SRPRBSRP receptor beta subunit9823OMA, EggNOG
Opossum100617644SRPRBSRP receptor beta subunit13616Inparanoid, OMA, EggNOG
Platypus100092127SRPRBSRP receptor beta subunit9258Inparanoid, EggNOG
Zebrafish436845srprbSRP receptor subunit beta7955ZDB-GENE-040718-311Inparanoid, OMA, EggNOG
Fruitfly47283SrpRbetaSignal recognition particle receptor beta7227FBgn0011509Inparanoid, EggNOG
S.cerevisiae853702SRP102Signal recognition particle receptor subunit beta4932S000001637Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.