🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SRSF2

DescriptionSerine/arginine-rich splicing factor 2

Gene and Protein Information

Gene ID6427
Uniprot Accession IDs Q01130 B3KWD5 B4DN89 H0YG49
Ensembl ID ENSP00000376276
Symbol SFRS2 SC35 PR264 SC-35 SFRS2 SFRS2A SRp30b
FamilyBelongs to the splicing factor SR family.
Sequence
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp619467SRSF2serine and arginine rich splicing factor 29598VGNC:9656Inparanoid, OMA, EggNOG
Macaque708105SRSF2serine and arginine rich splicing factor 29544Inparanoid, OMA
Mouse20382Srsf2serine/arginine-rich splicing factor 210090MGI:98284Inparanoid, OMA, EggNOG
Rat494445Srsf2serine and arginine rich splicing factor 210116RGD:1359422Inparanoid, OMA, EggNOG
Dog100856058SRSF2serine and arginine rich splicing factor 29615Inparanoid, OMA, EggNOG
Cow508312SRSF2serine and arginine rich splicing factor 29913Inparanoid, OMA, EggNOG
Chicken396195SRSF2serine and arginine rich splicing factor 29031CGNC:20312Inparanoid, OMA
Anole lizard100559180srsf2serine and arginine rich splicing factor 228377Inparanoid, OMA, EggNOG
Xenopus394953srsf2serine/arginine-rich splicing factor 28364XB-GENE-481125Inparanoid, OMA, EggNOG
Zebrafish406691srsf2aserine/arginine-rich splicing factor 2a7955ZDB-GENE-040426-2706Inparanoid, OMA, EggNOG
C. elegans173915rsp-4Probable splicing factor, arginine/serine-rich 46239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Serine/arginine-rich splicing factor 2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Serine/arginine-rich splicing factor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.