224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Chymotrypsin-like protease CTRL-1 |
|---|
Gene and Protein Information
| Gene ID | 1506 |
|---|---|
| Uniprot Accession IDs | P40313 |
| Ensembl ID | ENSP00000458537 |
| Symbol | CTRL1 CTRL1 |
| Family | Belongs to the peptidase S1 family. |
| Sequence | MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454179 | CTRL | chymotrypsin like | 9598 | VGNC:9027 | OMA, EggNOG |
| Macaque | 701625 | CTRL | chymotrypsin like | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 109660 | Ctrl | chymotrypsin-like | 10090 | MGI:88558 | Inparanoid, OMA, EggNOG |
| Rat | 117184 | Ctrl | chymotrypsin-like | 10116 | RGD:621501 | Inparanoid, OMA, EggNOG |
| Dog | 611100 | CTRL | chymotrypsin like | 9615 | VGNC:39707 | Inparanoid, OMA, EggNOG |
| Pig | 100621609 | CTRL | chymotrypsin like | 9823 | OMA, EggNOG | |
| Opossum | 100021711 | CTRL | chymotrypsin like | 13616 | Inparanoid, EggNOG | |
| Platypus | CTRL | chymotrypsin like [Source:HGNC Symbol;Acc:HGNC:2524] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100554181 | ctrl | chymotrypsin like | 28377 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.