🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RSAD2

DescriptionRadical S-adenosyl methionine domain-containing protein 2

Gene and Protein Information

Gene ID91543
Uniprot Accession IDs Q8WXG1 Q8WVI4
Ensembl ID ENSP00000371471
Symbol CIG5 cig5 vig1 cig33 2510004L01Rik
FamilyBelongs to the radical SAM superfamily. RSAD2 family.
Sequence
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459006RSAD2radical S-adenosyl methionine domain containing 29598VGNC:10754OMA, EggNOG
Macaque708720RSAD2radical S-adenosyl methionine domain containing 29544Inparanoid, OMA, EggNOG
Mouse58185Rsad2radical S-adenosyl methionine domain containing 210090MGI:1929628Inparanoid, OMA, EggNOG
Rat65190Rsad2radical S-adenosyl methionine domain containing 210116RGD:620495Inparanoid, OMA, EggNOG
Dog609005RSAD2radical S-adenosyl methionine domain containing 29615VGNC:45770Inparanoid, OMA, EggNOG
Horse100072610RSAD2radical S-adenosyl methionine domain containing 29796VGNC:22595Inparanoid, OMA, EggNOG
Cow506415RSAD2radical S-adenosyl methionine domain containing 29913VGNC:34176Inparanoid, OMA, EggNOG
Pig396752RSAD2radical S-adenosyl methionine domain containing 29823Inparanoid, OMA, EggNOG
OpossumRSAD2radical S-adenosyl methionine domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30908]13616Inparanoid, EggNOG
Platypus100080030RSAD2radical S-adenosyl methionine domain containing 29258Inparanoid, OMA, EggNOG
Chicken428650RSAD2radical S-adenosyl methionine domain containing 29031CGNC:12277Inparanoid, OMA, EggNOG
Anole lizard100565093rsad2radical S-adenosyl methionine domain containing 228377Inparanoid, OMA, EggNOG
Xenopus100493449rsad2radical S-adenosyl methionine domain containing 28364XB-GENE-485892Inparanoid, OMA, EggNOG
Zebrafish570456rsad2radical S-adenosyl methionine domain containing 27955ZDB-GENE-050913-129Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.