224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | DNA-directed RNA polymerases I, II, and III subunit RPABC3 |
|---|
Gene and Protein Information
| Gene ID | 5437 |
|---|---|
| Uniprot Accession IDs | P52434 C9J413 C9JBJ6 C9JCU7 C9JUA8 P53802 Q969R0 RNA polymerases I, II, and III subunit ABC3 |
| Ensembl ID | ENSP00000415536 |
| Symbol | RPB8 RPB17 RPABC3 |
| Family | Belongs to the eukaryotic RPB8 RNA polymerase subunit family. |
| Sequence | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 100429040 | POLR2H | RNA polymerase II subunit H | 9544 | Inparanoid, OMA | |
| Mouse | 245841 | Polr2h | polymerase (RNA) II (DNA directed) polypeptide H | 10090 | MGI:2384309 | Inparanoid, OMA |
| Horse | 100059115 | POLR2H | RNA polymerase II subunit H | 9796 | VGNC:21680 | Inparanoid, OMA |
| Cow | 505599 | POLR2H | RNA polymerase II subunit H | 9913 | VGNC:33142 | Inparanoid, OMA |
| Pig | 100628241 | POLR2H | RNA polymerase II subunit H | 9823 | Inparanoid, OMA | |
| Opossum | 100013916 | POLR2H | RNA polymerase II subunit H | 13616 | Inparanoid, OMA | |
| Platypus | 100089660 | POLR2H | RNA polymerase II subunit H | 9258 | Inparanoid, OMA | |
| Chicken | 424954 | POLR2H | RNA polymerase II subunit H | 9031 | CGNC:6474 | Inparanoid, OMA |
| Anole lizard | 100555951 | polr2h | RNA polymerase II subunit H | 28377 | Inparanoid, OMA | |
| Xenopus | 548867 | polr2h | polymerase (RNA) II subunit H | 8364 | XB-GENE-491773 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC3
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC3
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC3
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC3
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC3
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.