224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Rod outer segment membrane protein 1 |
|---|
Gene and Protein Information
| Gene ID | 6094 |
|---|---|
| Uniprot Accession IDs | Q03395 B2R978 ROSP1 |
| Ensembl ID | ENSP00000278833 |
| Symbol | TSPAN23 ROM RP7 ROSP1 TSPAN23 |
| Family | Belongs to the PRPH2/ROM1 family. |
| Sequence | MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107966160 | ROM1 | retinal outer segment membrane protein 1 | 9598 | VGNC:11670 | OMA, EggNOG |
| Mouse | 19881 | Rom1 | rod outer segment membrane protein 1 | 10090 | MGI:97998 | Inparanoid, OMA, EggNOG |
| Rat | 309201 | Rom1 | retinal outer segment membrane protein 1 | 10116 | RGD:1306070 | Inparanoid, OMA, EggNOG |
| Dog | 483786 | ROM1 | retinal outer segment membrane protein 1 | 9615 | VGNC:45690 | Inparanoid, OMA, EggNOG |
| Horse | 100063558 | ROM1 | retinal outer segment membrane protein 1 | 9796 | VGNC:22499 | Inparanoid, OMA, EggNOG |
| Cow | 281465 | ROM1 | retinal outer segment membrane protein 1 | 9913 | VGNC:34084 | Inparanoid, OMA, EggNOG |
| Opossum | 100012184 | ROM1 | retinal outer segment membrane protein 1 | 13616 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.