🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

RUVBL2

DescriptionRuvB-like 2

Gene and Protein Information

Gene ID10856
Uniprot Accession IDs Q9Y230 B3KQ59 E7ETE5 Q6FIB9 Q6PK27 Q9Y361
Ensembl ID ENSP00000473172
Symbol INO80J TIP48 TIP49B RVB2 TIH2 ECP51 TIP48 CGI-46 ECP-51 INO80J REPTIN TIP49B TAP54-beta
FamilyBelongs to the RuvB family.
Sequence
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp468949RUVBL2RuvB like AAA ATPase 29598VGNC:8324OMA, EggNOG
Macaque100428794RUVBL2RuvB like AAA ATPase 29544Inparanoid, OMA, EggNOG
Mouse20174Ruvbl2RuvB-like protein 210090MGI:1342299Inparanoid, OMA
Rat292907Ruvbl2RuvB-like AAA ATPase 210116RGD:1306509Inparanoid, OMA, EggNOG
Dog476418RUVBL2RuvB like AAA ATPase 29615VGNC:45812Inparanoid, OMA, EggNOG
Horse100051665RUVBL2RuvB like AAA ATPase 29796VGNC:22633Inparanoid, OMA, EggNOG
Cow511048RUVBL2RuvB like AAA ATPase 29913VGNC:34224Inparanoid, OMA, EggNOG
Pig100511637RUVBL2RuvB like AAA ATPase 29823Inparanoid, OMA, EggNOG
Opossum100030444RUVBL2RuvB like AAA ATPase 213616Inparanoid, OMA, EggNOG
Anole lizard100558613ruvbl2RuvB like AAA ATPase 228377Inparanoid, OMA, EggNOG
Xenopus448144ruvbl2RuvB like AAA ATPase 28364XB-GENE-483344Inparanoid, OMA, EggNOG
Zebrafish317678ruvbl2RuvB-like AAA ATPase 27955ZDB-GENE-030109-1Inparanoid, OMA, EggNOG
C. elegans177458ruvb-2RuvB-like 26239Inparanoid, OMA, EggNOG
Fruitfly40092reptreptin7227FBgn0040075Inparanoid, EggNOG
S.cerevisiae855841RVB2RuvB family ATP-dependent DNA helicase reptin4932S000006156Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.