🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

S100A6

DescriptionProtein S100-A6

Gene and Protein Information

Gene ID6277
Uniprot Accession IDs P06703 D3DV39 Q5RHS4
Ensembl ID ENSP00000357709
Symbol CACY 2A9 PRA 5B10 CABP CACY S10A6
FamilyBelongs to the S-100 family.
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp738116S100A6S100 calcium binding protein A69598VGNC:1529OMA, EggNOG
Macaque715169S100A6S100 calcium binding protein A69544Inparanoid, OMA, EggNOG
Mouse20200S100a6S100 calcium binding protein A6 (calcyclin)10090MGI:1339467Inparanoid, OMA, EggNOG
Rat85247S100a6S100 calcium binding protein A610116RGD:620264Inparanoid, OMA, EggNOG
Dog480143S100A6S100 calcium binding protein A69615VGNC:45832Inparanoid, OMA, EggNOG
Horse100033887S100A6S100 calcium binding protein A69796VGNC:22655Inparanoid, OMA, EggNOG
Pig733608S100A6S100 calcium binding protein A69823Inparanoid, OMA, EggNOG
Opossum100019435LOC100019435protein S100-A6-like13616OMA, EggNOG
Platypus100093336LOC100093336protein S100-A69258OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-A6
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-A6
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-A6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.