🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GJC3

DescriptionGap junction gamma-3 protein

Gene and Protein Information

Gene ID349149
Uniprot Accession IDs Q8NFK1 A4D296 Q86XI9
Ensembl ID ENSP00000325775
Symbol GJE1 CX29 GJE1 CX30.2 CX31.3
FamilyBelongs to the connexin family. Gamma-type subfamily.
Sequence
MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737656GJC3gap junction protein gamma 39598VGNC:14017OMA, EggNOG
Macaque100424576LOC100424576gap junction gamma-3 protein9544OMA, EggNOG
Mouse118446Gjc3gap junction protein, gamma 310090MGI:2153041Inparanoid, OMA, EggNOG
Rat288529Gjc3gap junction protein, gamma 310116RGD:727930Inparanoid, OMA, EggNOG
Dog489850GJC3gap junction protein gamma 39615VGNC:54027Inparanoid, OMA, EggNOG
Horse100068490GJC3gap junction protein gamma 39796VGNC:18361Inparanoid, OMA, EggNOG
Cow539991GJC3gap junction protein gamma 39913VGNC:29384Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction gamma-3 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction gamma-3 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.