224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Renalase |
|---|
Gene and Protein Information
| Gene ID | 55328 |
|---|---|
| Uniprot Accession IDs | Q5VYX0 Q9BS33 Q9NUP8 |
| Ensembl ID | ENSP00000332530 |
| Symbol | C10orf59 C10orf59 RENALASE |
| Family | Belongs to the renalase family. |
| Sequence | MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450581 | RNLS | renalase, FAD dependent amine oxidase | 9598 | VGNC:12459 | OMA, EggNOG |
| Macaque | RNLS | renalase, FAD dependent amine oxidase [Source:HGNC Symbol;Acc:HGNC:25641] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 67795 | Rnls | renalase, FAD-dependent amine oxidase | 10090 | MGI:1915045 | Inparanoid, OMA, EggNOG |
| Rat | 361751 | Rnls | renalase, FAD-dependent amine oxidase | 10116 | RGD:1309804 | Inparanoid, OMA, EggNOG |
| Dog | 610448 | RNLS | renalase, FAD dependent amine oxidase | 9615 | VGNC:45681 | Inparanoid, OMA, EggNOG |
| Horse | 100062318 | RNLS | renalase, FAD dependent amine oxidase | 9796 | VGNC:22490 | Inparanoid, OMA, EggNOG |
| Opossum | 100012984 | RNLS | renalase, FAD dependent amine oxidase | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100555221 | rnls | renalase, FAD dependent amine oxidase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100037883 | rnls | renalase, FAD-dependent amine oxidase | 8364 | XB-GENE-5831223 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436880 | rnls | renalase, FAD-dependent amine oxidase | 7955 | ZDB-GENE-040718-351 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.