🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

MRPL1

Description39S ribosomal protein L1, mitochondrial

Gene and Protein Information

Gene ID65008
Uniprot Accession IDs Q9BYD6 A6NG03 Q4W5B8 Q6IAG4 Q96BW3 Q9H793 Q9NRL5 L1mt
Ensembl ID ENSP00000315017
Symbol L1MT BM022 MRP-L1
FamilyBelongs to the universal ribosomal protein uL1 family.
Sequence
MAAAVRCMGRALIHHQRHSLSKMVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461228MRPL1mitochondrial ribosomal protein L19598VGNC:748OMA, EggNOG
Mouse94061Mrpl1mitochondrial ribosomal protein L110090MGI:2137202Inparanoid, OMA, EggNOG
Rat289491Mrpl1mitochondrial ribosomal protein L110116RGD:1306850Inparanoid, OMA, EggNOG
Dog478443MRPL1mitochondrial ribosomal protein L19615VGNC:43375Inparanoid, OMA, EggNOG
Horse100059167MRPL1mitochondrial ribosomal protein L19796VGNC:20321Inparanoid, OMA, EggNOG
Cow504835MRPL1mitochondrial ribosomal protein L19913VGNC:31614Inparanoid, OMA, EggNOG
Pig100513028MRPL1mitochondrial ribosomal protein L19823OMA, EggNOG
Opossum100009823MRPL1mitochondrial ribosomal protein L113616Inparanoid, OMA, EggNOG
PlatypusMRPL1mitochondrial ribosomal protein L1 [Source:HGNC Symbol;Acc:HGNC:14275]9258OMA, EggNOG
Chicken422507MRPL1mitochondrial ribosomal protein L19031CGNC:7856Inparanoid, OMA, EggNOG
Anole lizard100553249mrpl1mitochondrial ribosomal protein L128377Inparanoid, OMA, EggNOG
Xenopus548880mrpl1mitochondrial ribosomal protein L18364XB-GENE-952988Inparanoid, OMA, EggNOG
Zebrafish553284mrpl1mitochondrial ribosomal protein L17955ZDB-GENE-060526-311Inparanoid, OMA, EggNOG
C. elegans177549mrpl-1Mitochondrial Ribosomal Protein, Large6239OMA, EggNOG
Fruitfly40980mRpL1mitochondrial ribosomal protein L17227FBgn0037566Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribosomal protein    /    39S ribosomal protein L1, mitochondrial
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Ribosomal protein    /    39S ribosomal protein L1, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.