224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | C-X-C motif chemokine 10 |
|---|
Gene and Protein Information
| Gene ID | 3627 |
|---|---|
| Uniprot Accession IDs | P02778 Q96QJ5 |
| Ensembl ID | ENSP00000305651 |
| Symbol | INP10 SCYB10 C7 IFI10 INP10 IP-10 crg-2 mob-1 SCYB10 gIP-10 |
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
| Sequence | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461242 | CXCL10 | C-X-C motif chemokine ligand 10 | 9598 | VGNC:8659 | OMA, EggNOG |
| Macaque | 574243 | CXCL10 | C-X-C motif chemokine ligand 10 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15945 | Cxcl10 | chemokine (C-X-C motif) ligand 10 | 10090 | MGI:1352450 | Inparanoid, OMA, EggNOG |
| Rat | 245920 | Cxcl10 | C-X-C motif chemokine ligand 10 | 10116 | RGD:620209 | Inparanoid, OMA, EggNOG |
| Dog | 478432 | CXCL10 | C-X-C motif chemokine ligand 10 | 9615 | VGNC:49645 | Inparanoid, OMA, EggNOG |
| Horse | 100050993 | CXCL10 | C-X-C motif chemokine ligand 10 | 9796 | VGNC:16981 | Inparanoid, OMA, EggNOG |
| Cow | 615107 | CXCL10 | C-X-C motif chemokine ligand 10 | 9913 | VGNC:27846 | Inparanoid, OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.