224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | E3 ubiquitin-protein ligase RNF135 |
|---|
Gene and Protein Information
| Gene ID | 84282 |
|---|---|
| Uniprot Accession IDs | Q8IUD6 A0AVM5 B2R7G9 B6ZLM5 F5GX60 Q9BSE9 |
| Ensembl ID | ENSP00000328340 |
| Symbol | L13 MMFD REUL Riplet |
| Sequence | MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454562 | RNF135 | ring finger protein 135 | 9598 | VGNC:9565 | OMA, EggNOG |
| Mouse | 71956 | Rnf135 | ring finger protein 135 | 10090 | MGI:1919206 | Inparanoid, OMA, EggNOG |
| Rat | 303351 | Rhot1 | ras homolog family member T1 | 10116 | RGD:1307023 | OMA, EggNOG |
| Cow | 511125 | RNF135 | ring finger protein 135 | 9913 | Inparanoid, OMA | |
| Pig | 100522211 | RNF135 | ring finger protein 135 | 9823 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.