CD79B

DescriptionB-cell antigen receptor complex-associated protein beta chain

Gene and Protein Information

Gene ID974
Uniprot Accession IDs P40259 Q53FS2 Q9BU06
Ensembl ID ENSP00000376544
Symbol B29 IGB B29 IGB AGM6
Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp454773CD79BCD79b molecule9598VGNC:9180OMA, EggNOG
Mouse15985Cd79bCD79B antigen10090MGI:96431Inparanoid, OMA, EggNOG
Rat171055Cd79bCD79b molecule10116RGD:620012Inparanoid, OMA, EggNOG
Dog609449CD79BCD79b molecule9615VGNC:38974Inparanoid, OMA, EggNOG
Cow509801CD79BCD79b molecule9913VGNC:27047Inparanoid, OMA, EggNOG
Pig100511898CD79BCD79b molecule9823Inparanoid, OMA, EggNOG
Opossum100026330CD79BCD79b molecule13616Inparanoid, OMA, EggNOG
Chicken419940CD79BCD79b molecule9031CGNC:147Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein beta chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein beta chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein beta chain
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein beta chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.