224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | E3 ubiquitin-protein ligase RNF115 |
|---|
Gene and Protein Information
| Gene ID | 27246 |
|---|---|
| Uniprot Accession IDs | Q9Y4L5 A8K3Y4 Q5T2V9 Q7Z2J2 |
| Ensembl ID | ENSP00000463650 |
| Symbol | ZNF364 BCA2 ZNF364 |
| Sequence | MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457980 | RNF115 | ring finger protein 115 | 9598 | VGNC:1495 | OMA, EggNOG |
| Macaque | 697067 | RNF115 | ring finger protein 115 | 9544 | Inparanoid, OMA | |
| Mouse | 67845 | Rnf115 | ring finger protein 115 | 10090 | MGI:1915095 | Inparanoid, OMA, EggNOG |
| Rat | 362002 | Rnf115 | ring finger protein 115 | 10116 | RGD:1305315 | Inparanoid, OMA |
| Dog | 612818 | RNF115 | ring finger protein 115 | 9615 | VGNC:45624 | Inparanoid, OMA, EggNOG |
| Horse | RNF115 | ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154] | 9796 | OMA, EggNOG | ||
| Cow | 614061 | RNF115 | ring finger protein 115 | 9913 | VGNC:34013 | Inparanoid, OMA, EggNOG |
| Opossum | 100012646 | RNF115 | ring finger protein 115 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100216180 | rnf115 | ring finger protein 115 | 8364 | XB-GENE-993231 | Inparanoid, OMA, EggNOG |
| Zebrafish | 790928 | rnf115 | ring finger protein 115 | 7955 | ZDB-GENE-061215-82 | Inparanoid, OMA, EggNOG |
| Fruitfly | 41080 | CG11982 | CG11982 gene product from transcript CG11982-RA | 7227 | FBgn0037653 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.