🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CEP70

DescriptionCentrosomal protein of 70 kDa

Gene and Protein Information

Gene ID80321
Uniprot Accession IDs Q8NHQ1 B7Z5I8 B7Z7E8 D3DNE9 F5GZX8 Q96B31 Q9H2C3 Q9H2Z1 Q9H940 Cep70
Ensembl ID ENSP00000264982
Symbol BITE BITE
Sequence
MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEKLNLQKDLETRPTQHELRLYKQQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460728CEP70centrosomal protein 709598VGNC:5039OMA, EggNOG
Macaque716263CEP70centrosomal protein 709544Inparanoid, OMA, EggNOG
Mouse68121Cep70centrosomal protein 7010090MGI:1915371Inparanoid, OMA, EggNOG
Rat367153Cep70centrosomal protein 7010116RGD:1561486Inparanoid, OMA, EggNOG
Dog477084CEP70centrosomal protein 709615VGNC:39135Inparanoid, OMA, EggNOG
Horse100064729CEP70centrosomal protein 709796VGNC:16425Inparanoid, OMA, EggNOG
Cow100301027CEP70centrosomal protein 709913VGNC:27211Inparanoid, OMA, EggNOG
Pig100621655CEP70centrosomal protein 709823Inparanoid, OMA, EggNOG
Opossum100024437CEP70centrosomal protein 7013616Inparanoid, OMA, EggNOG
Chicken429044CEP70centrosomal protein 709031CGNC:9165Inparanoid, OMA, EggNOG
Anole lizard100555185cep70centrosomal protein 7028377Inparanoid, OMA, EggNOG
Zebrafish100136857cep70centrosomal protein 707955ZDB-GENE-070705-311Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.