SSTR5

DescriptionSomatostatin receptor type 5

Gene and Protein Information

Gene ID6755
Uniprot Accession IDs P35346 P34988 Q541E0 Q9UJI5 SS-5-R
Ensembl ID ENSP00000293897
Symbol SS-5-R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse20609Sstr5somatostatin receptor 510090MGI:894282Inparanoid, OMA, EggNOG
Rat25354Sstr5somatostatin receptor 510116RGD:3765Inparanoid, OMA, EggNOG
Dog403454SSTR5somatostatin receptor 59615VGNC:46846Inparanoid, OMA, EggNOG
Horse100067398SSTR5somatostatin receptor 59796VGNC:23623Inparanoid, OMA, EggNOG
Cow510344SSTR5somatostatin receptor 59913VGNC:35328Inparanoid, OMA, EggNOG
Opossum100616853SSTR5somatostatin receptor 513616Inparanoid, OMA, EggNOG
PlatypusSSTR5somatostatin receptor 5 [Source:HGNC Symbol;Acc:HGNC:11334]9258OMA, EggNOG
Chicken427667SSTR5somatostatin receptor 59031CGNC:53162Inparanoid, OMA
Anole lizard100567150sstr5somatostatin receptor 528377Inparanoid, OMA
Xenopus100486456sstr5somatostatin receptor 58364XB-GENE-949452Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Somatostatin receptor type 5
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Somatostatin receptor type 5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.