🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SUCNR1

DescriptionSuccinate receptor 1

Gene and Protein Information

Gene ID56670
Uniprot Accession IDs Q9BXA5 A8K305 Q8TDQ8
Ensembl ID ENSP00000355156
Symbol GPR91 GPR91
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp738824SUCNR1succinate receptor 19598VGNC:12200OMA, EggNOG
Mouse84112Sucnr1succinate receptor 110090MGI:1934135Inparanoid, OMA, EggNOG
Rat408199Sucnr1succinate receptor 110116RGD:1303193Inparanoid, OMA, EggNOG
Dog485719SUCNR1succinate receptor 19615VGNC:46968Inparanoid, OMA, EggNOG
Horse100056372SUCNR1succinate receptor 19796VGNC:23745Inparanoid, OMA, EggNOG
Cow539622SUCNR1succinate receptor 19913VGNC:35458OMA, EggNOG
Pig100739158SUCNR1succinate receptor 19823OMA, EggNOG
Platypus100083905SUCNR1succinate receptor 19258OMA, EggNOG
Chicken771768SUCNR1succinate receptor 19031CGNC:7886Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Succinate receptor 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.