224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Triggering receptor expressed on myeloid cells 2 |
|---|
Gene and Protein Information
| Gene ID | 54209 |
|---|---|
| Uniprot Accession IDs | Q9NZC2 Q8N5H8 Q8WYN6 TREM-2 |
| Ensembl ID | ENSP00000362205 |
| Symbol | PLOSL2 TREM-2 Trem2a Trem2b Trem2c |
| Sequence | MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748470 | TREM2 | triggering receptor expressed on myeloid cells 2 | 9598 | VGNC:3757 | OMA, EggNOG |
| Macaque | 719740 | TREM2 | triggering receptor expressed on myeloid cells 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 83433 | Trem2 | triggering receptor expressed on myeloid cells 2 | 10090 | MGI:1913150 | Inparanoid, OMA, EggNOG |
| Rat | 301227 | Trem2 | triggering receptor expressed on myeloid cells 2 | 10116 | RGD:1309841 | Inparanoid, OMA, EggNOG |
| Dog | 474898 | TREM2 | triggering receptor expressed on myeloid cells 2 | 9615 | VGNC:47794 | Inparanoid, OMA, EggNOG |
| Horse | 100066180 | TREM2 | triggering receptor expressed on myeloid cells 2 | 9796 | VGNC:24482 | Inparanoid, OMA, EggNOG |
| Cow | 506467 | TREM2 | triggering receptor expressed on myeloid cells 2 | 9913 | VGNC:36299 | Inparanoid, OMA, EggNOG |
| Opossum | 100030137 | TREM2 | triggering receptor expressed on myeloid cells 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100561499 | LOC100561499 | triggering receptor expressed on myeloid cells 2 | 28377 | OMA, EggNOG | |
| Xenopus | 100126214 | trem2 | triggering receptor expressed on myeloid cells 2 | 8364 | XB-GENE-922281 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.