🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TXNDC12

DescriptionThioredoxin domain-containing protein 12

Gene and Protein Information

Gene ID51060
Uniprot Accession IDs O95881 B3KQS0 Q5T1T4 Q96H50
Ensembl ID ENSP00000360688
Symbol TLP19 AG1 AGR1 ERP16 ERP18 ERP19 TLP19 hAG-1 PDIA16 hTLP19
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100610643TXNDC12thioredoxin domain containing 129598VGNC:9409OMA, EggNOG
Mouse66073Txndc12thioredoxin domain containing 12 (endoplasmic reticulum)10090MGI:1913323Inparanoid, OMA, EggNOG
Rat298370Txndc12thioredoxin domain containing 1210116RGD:1305960Inparanoid, OMA, EggNOG
Dog609843TXNDC12thioredoxin domain containing 129615VGNC:48011Inparanoid, OMA, EggNOG
Horse100062254TXNDC12thioredoxin domain containing 129796VGNC:24677Inparanoid, OMA, EggNOG
Cow506991TXNDC12thioredoxin domain containing 129913VGNC:36535Inparanoid, OMA, EggNOG
Pig100517534TXNDC12thioredoxin domain containing 129823OMA, EggNOG
Opossum103095270TXNDC12thioredoxin domain containing 1213616Inparanoid, OMA, EggNOG
Chicken772208TXNDC12thioredoxin domain containing 129031CGNC:8025Inparanoid, OMA, EggNOG
Anole lizard100562080txndc12thioredoxin domain containing 1228377Inparanoid, OMA, EggNOG
Zebrafish324900txndc12thioredoxin domain containing 12 (endoplasmic reticulum)7955ZDB-GENE-050522-497Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    reductase    /    Thioredoxin domain-containing protein 12
protein    /    oxidoreductase    /    surfactant    /    Thioredoxin domain-containing protein 12
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Reductase    /    Thioredoxin domain-containing protein 12

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.