224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Dipeptidase 1 |
|---|
Gene and Protein Information
| Gene ID | 1800 |
|---|---|
| Uniprot Accession IDs | P16444 D3DX80 Q96AK2 |
| Ensembl ID | ENSP00000376807 |
| Symbol | MDP RDP MDP RDP MBD1 |
| Family | Belongs to the metallo-dependent hydrolases superfamily. Peptidase M19 family. |
| Sequence | MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 699725 | DPEP1 | dipeptidase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13479 | Dpep1 | dipeptidase 1 (renal) | 10090 | MGI:94917 | Inparanoid, OMA, EggNOG |
| Rat | 94199 | Dpep1 | dipeptidase 1 | 10116 | RGD:620324 | Inparanoid, OMA, EggNOG |
| Dog | 479611 | DPEP1 | dipeptidase 1 | 9615 | VGNC:49599 | Inparanoid, OMA |
| Horse | 100052197 | DPEP1 | dipeptidase 1 | 9796 | VGNC:49047 | Inparanoid, OMA |
| Cow | 514685 | DPEP1 | dipeptidase 1 | 9913 | VGNC:49143 | Inparanoid, OMA |
| Pig | 397196 | DPEP1 | dipeptidase 1 | 9823 | Inparanoid, OMA | |
| Platypus | 100080399 | DPEP1 | dipeptidase 1 | 9258 | Inparanoid, OMA | |
| Anole lizard | 100552685 | dpep1 | dipeptidase 1 | 28377 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.