224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Vesicle-associated membrane protein 1 |
|---|
Gene and Protein Information
| Gene ID | 6843 |
|---|---|
| Uniprot Accession IDs | P23763 A8MVP3 D3DUR3 O75468 Q15857 Q6FG94 Q8IVC9 VAMP-1 |
| Ensembl ID | ENSP00000379602 |
| Symbol | SYB1 SYB1 CMS25 SPAX1 VAMP-1 |
| Family | Belongs to the synaptobrevin family. |
| Sequence | MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 22317 | Vamp1 | vesicle-associated membrane protein 1 | 10090 | MGI:1313276 | Inparanoid, OMA, EggNOG |
| Rat | 25624 | Vamp1 | vesicle-associated membrane protein 1 | 10116 | RGD:3948 | Inparanoid, OMA |
| Dog | 486726 | VAMP1 | vesicle associated membrane protein 1 | 9615 | VGNC:54386 | Inparanoid, OMA, EggNOG |
| Horse | 100059722 | VAMP1 | vesicle associated membrane protein 1 | 9796 | VGNC:24875 | Inparanoid, OMA, EggNOG |
| Cow | 513621 | VAMP1 | vesicle associated membrane protein 1 | 9913 | VGNC:36756 | Inparanoid, OMA, EggNOG |
| Pig | VAMP1 | vesicle associated membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:12642] | 9823 | OMA, EggNOG | ||
| Chicken | 418273 | VAMP1 | vesicle-associated membrane protein 1 (synaptobrevin 1) | 9031 | CGNC:50722 | Inparanoid, OMA |
| Anole lizard | 100565724 | vamp1 | vesicle associated membrane protein 1 | 28377 | Inparanoid, EggNOG | |
| Xenopus | vamp2 | vesicle associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-5788095] | 8364 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.