🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

VAMP3

DescriptionVesicle-associated membrane protein 3

Gene and Protein Information

Gene ID9341
Uniprot Accession IDs Q15836 Q9BRV4 VAMP-3
Ensembl ID ENSP00000054666
Symbol SYB3 CEB
FamilyBelongs to the synaptobrevin family.
Sequence
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457906VAMP3vesicle associated membrane protein 39598VGNC:7022Inparanoid, OMA, EggNOG
Macaque707972VAMP3vesicle associated membrane protein 39544Inparanoid, EggNOG
Mouse22319Vamp3vesicle-associated membrane protein 310090MGI:1321389Inparanoid, OMA, EggNOG
Rat29528Vamp3vesicle-associated membrane protein 310116RGD:61880Inparanoid, OMA, EggNOG
Dog102154970VAMP3vesicle associated membrane protein 39615VGNC:48223Inparanoid, OMA, EggNOG
Horse100630321VAMP3vesicle associated membrane protein 39796VGNC:50791Inparanoid, OMA, EggNOG
Cow505379VAMP3vesicle associated membrane protein 39913VGNC:36757Inparanoid, OMA, EggNOG
Chicken419368VAMP3vesicle-associated membrane protein 39031CGNC:359Inparanoid, OMA, EggNOG
Anole lizard100552036vamp3vesicle associated membrane protein 328377Inparanoid, EggNOG
Xenopusvamp3vesicle associated membrane protein 3 [Source:Xenbase;Acc:XB-GENE-1014996]8364OMA, EggNOG
Zebrafish415163vamp3vesicle-associated membrane protein 3 (cellubrevin)7955ZDB-GENE-040625-45Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.