UBE2C

DescriptionUbiquitin-conjugating enzyme E2 C

Gene and Protein Information

Gene ID11065
Uniprot Accession IDs O00762 A6NP33 E1P5N7 G3XAB7
Ensembl ID ENSP00000348838
Symbol UBCH10 UBCH10 dJ447F3.2
FamilyBelongs to the ubiquitin-conjugating enzyme family.
Sequence
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque709380UBE2Cubiquitin conjugating enzyme E2 C9544Inparanoid, OMA, EggNOG
Mouse68612Ube2cubiquitin-conjugating enzyme E2C10090MGI:1915862Inparanoid, OMA, EggNOG
Rat296368Ube2cubiquitin-conjugating enzyme E2C10116RGD:1305382Inparanoid, OMA, EggNOG
Dog485898UBE2Cubiquitin conjugating enzyme E2 C9615VGNC:48049Inparanoid, OMA, EggNOG
Horse100056334UBE2Cubiquitin conjugating enzyme E2 C9796VGNC:24714Inparanoid, OMA, EggNOG
Cow506962UBE2Cubiquitin conjugating enzyme E2 C9913VGNC:36578Inparanoid, OMA, EggNOG
Pig100153133UBE2Cubiquitin conjugating enzyme E2 C9823Inparanoid, OMA, EggNOG
Xenopus100124324ube2cubiquitin conjugating enzyme E2 C8364XB-GENE-971108Inparanoid, OMA, EggNOG
Fruitfly44118vihvihar7227FBgn0264848Inparanoid, OMA, EggNOG
S.cerevisiae854517UBC11putative E2 ubiquitin-protein ligase UBC114932S000005866Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.